


| Basic Information | |
|---|---|
| Taxon OID | 3300017482 Open in IMG/M |
| Scaffold ID | Ga0186907_15349 Open in IMG/M |
| Source Dataset Name | Hotspring sediment microbial communities from Obsidian Pool, Yellowstone National Park, Wyoming, USA ? Obsidian 2. Combined Assembly of Gp0212715, Gp0212716 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Stanford University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5441 |
| Total Scaffold Genes | 9 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (22.22%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Hyperthermophilic Archaeal Virus 1 | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring Sediment → Yellowstone National Park Obsidian Pool Microbial Communities |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | YNP, Wyoming, USA | |||||||
| Coordinates | Lat. (o) | 44.428 | Long. (o) | -110.5885 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000750 | Metagenome / Metatranscriptome | 908 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0186907_153496 | F000750 | N/A | MPMYLPLIVTAFLFSYWFFKKRFKAKPLSLPINVQTGDIIHGAFGSLLANLSMHQMYVDVMVGVLMYLAYQFTEFAVKHDEVYKDIATFMAGYFGTLAVGGIPL |
| ⦗Top⦘ |