


| Basic Information | |
|---|---|
| Taxon OID | 3300017312 Open in IMG/M |
| Scaffold ID | Ga0186226_121112 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic communities from Southern Kattegat in F/2 medium with seawater, 15 C, 33 psu salinity and 741 ?mol photons light - Heterocapsa rotundata SCCAP K-0483 (MMETSP0503) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Center for Genome Resources |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 692 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Chrysophyceae → Chromulinales → Chromulinaceae → Spumella → Spumella elongata | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Southern Kattegat, Buoy St. | |||||||
| Coordinates | Lat. (o) | 56.0 | Long. (o) | 11.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F047708 | Metatranscriptome | 149 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0186226_1211121 | F047708 | N/A | MAPLPGTEPPELARSKVINDTKWLIYCCCGGQGIGPFADPLVAAEVKQLCIRGSSSTTNIMDDDGLCNSVQVCLCIQQQMQIPPLENAPACAICNKKFGGSMGSTKWKATLFDQSKIMDETFWLYYFICSGCGINAKMDNGLFSAQGKSLCCRGYENLESPVIDGVFCSQVGTTLCFWQECQIPPAKPNPTIAICTWRLNKEQ |
| ⦗Top⦘ |