


| Basic Information | |
|---|---|
| Taxon OID | 3300017286 Open in IMG/M |
| Scaffold ID | Ga0186688_1026916 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of coastal eukaryotic communities from Indian River Bay, Delaware, USA in L1 medium, 22 C, 34 psu salinity and 695 ?mol photons light - Prorocentrum minimum CCMP 2233 (MMETSP0267) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Center for Genome Resources |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 833 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota | (Source: Euk_MAG) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Indian River Bay, Delaware | |||||||
| Coordinates | Lat. (o) | 38.59 | Long. (o) | -75.1 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F016353 | Metatranscriptome | 247 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0186688_10269161 | F016353 | N/A | WGWQRIRYLAVKTWIDYWATRNTEKLIVIHASGEVLYAGCDENTIQYKYDEIITASGGTQKVVLAAEVSPWPMGLAWRYDQTAGIATTQSNFLSTVGVSSTFASTYADCTNSTVGYCTSPPSYKFANGGFIMGPIGDIADMLADMYYYADSESMLINEYFLHNPDKVALDYAGLLVLSLNNMKLDSGIPVTVESNAGTKSFKNLITGGSVCFVHGGGNSFDALRVLAQELLSDA |
| ⦗Top⦘ |