


| Basic Information | |
|---|---|
| Taxon OID | 3300017258 Open in IMG/M |
| Scaffold ID | Ga0186356_129209 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic communities from North Pacific Ocean in marine media K with soil extract, 18 C, 36 psu salinity and 435 ?mol photons light - Haptolina ericina CCMP 281 (MMETSP1096) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Center for Genome Resources |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 674 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | North Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 49.6 | Long. (o) | -140.6166 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F043734 | Metagenome / Metatranscriptome | 155 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0186356_1292091 | F043734 | GAGG | MFRMKQLGVPAMRWGGAFGAIGFFLLFEDLPQLILQTQYGNFPGWHGVAVAFGVIKDKSAEDA |
| ⦗Top⦘ |