


| Basic Information | |
|---|---|
| Taxon OID | 3300017234 Open in IMG/M |
| Scaffold ID | Ga0186611_119218 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic communities from Antarctic Ocean in f/2-R medium with seawater, 210 ?M silicate, -2 C, 35 psu salinity and 502 ?mol photons light - Fragilariopsis kerguelensis L2-C3 (MMETSP0906) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Center for Genome Resources |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 750 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Southern Ocean | |||||||
| Coordinates | Lat. (o) | -48.1 | Long. (o) | -24.25 | Alt. (m) | Depth (m) | 20 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F038969 | Metatranscriptome | 164 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0186611_1192181 | F038969 | N/A | MSTAAIDAFSNKSAPPVAASTTLNRHNAQQEAQQEPPSHTLSSRTVGGHPSAGLSERPTRRKSALSFSPADIGGAATLLSMKLEGAKAIANPTQVLTDASYVVMDPHKFFPDIQISKLRMQYAQVFGRLMVLGTTFLPHHGVHPEELAVQLFLLSVSMKPIIRSVQLYNCITKSAKGNCAEECALEFQELEAALNIKTTSAVVV |
| ⦗Top⦘ |