


| Basic Information | |
|---|---|
| Taxon OID | 3300017156 Open in IMG/M |
| Scaffold ID | Ga0186603_120047 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic communities from Antarctic Ocean in modified f/2 medium with seawater, 3 C, 33.6 psu salinity and 358 ?mol photons light - Corethron pennatum L29A3 (MMETSP0171) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Center for Genome Resources |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 682 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota | (Source: Euk_MAG) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Southern Ocean | |||||||
| Coordinates | Lat. (o) | -47.33333 | Long. (o) | -15.65 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F094655 | Metatranscriptome | 105 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0186603_1200471 | F094655 | AGGAGG | MFTPSPPGCAVIPGMECNEENLGIYDYTASIGGCLLFLSCIIILYACVRLFLVARQSDERMLAYRSSERSNYATSNTVAVSGLFYSGGNLLIVLPLIILIIGVFAKVDGASFFWTFFGLQWAIFQPLQGFFNALVYFRPQYLEYKKEKRNEKVSQTTSATSP |
| ⦗Top⦘ |