


| Basic Information | |
|---|---|
| Taxon OID | 3300016843 Open in IMG/M |
| Scaffold ID | Ga0186454_104959 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic communities from English Channel in L1 medium with seawater, 14 C, 33 psu salinity and 551 ?mol photons light - unclassified eukaryote RCC 1871 (MMETSP1456) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Center for Genome Resources |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 955 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota | (Source: Euk_MAG) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | English Channel | |||||||
| Coordinates | Lat. (o) | 48.75 | Long. (o) | -3.95 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F079415 | Metagenome / Metatranscriptome | 115 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0186454_1049591 | F079415 | AGG | MKSTALAVALAVALAVATVSTCLAEKEESYLEAATHFCETMTTNNKQCGWVGMDDPRYENDREVKIDQIGCPQCGTVWGGWYQENEAGTGGSVRYPPNAIIGPGINGAGYFQFFPRYLSLGCRGKKVEVQAVYKLIDAGEEQIGSGPYYAGLSLTDTPWYPKNLTRCSIGTGQEPSNTLSNCRECQQSASGEGGCPIEKDTWYMDTMILDMPEQCPPSQDGPVMPSIFVNPYQTLNVSAFTATPIT |
| ⦗Top⦘ |