


| Basic Information | |
|---|---|
| Taxon OID | 3300015359 Open in IMG/M |
| Scaffold ID | Ga0134085_10573297 Open in IMG/M |
| Source Dataset Name | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 522 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Angelo Coastal Reserve, California | |||||||
| Coordinates | Lat. (o) | 39.7181 | Long. (o) | -123.6527 | Alt. (m) | Depth (m) | .2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F052126 | Metagenome / Metatranscriptome | 143 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0134085_105732971 | F052126 | GAG | MRAILVVVANILGEQAFQVAFVNCDDVIKEITTATPYPTLCHPILPRTFERSADRTHAQGSNRRGDFQSILGITIKDHEPRSRSKWKCFSQLL |
| ⦗Top⦘ |