


| Basic Information | |
|---|---|
| Taxon OID | 3300014962 Open in IMG/M |
| Scaffold ID | Ga0134315_1024022 Open in IMG/M |
| Source Dataset Name | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Tennessee |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 945 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water → Surface And Well Water Microbial Communities From Bara Haldia, Bangladesh |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Bangladesh: Bara Haldia, Matlab upazilla | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002098 | Metagenome / Metatranscriptome | 593 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0134315_10240222 | F002098 | AGGAG | MGYKKGADGVTKKGKTVGKNLGDSGPTLGIESGPKHSGSKGGKRNIDMKTMGRGLAKVAAQKRG* |
| ⦗Top⦘ |