NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0119960_1039186

Scaffold Ga0119960_1039186


Overview

Basic Information
Taxon OID3300014811 Open in IMG/M
Scaffold IDGa0119960_1039186 Open in IMG/M
Source Dataset NameAquatic viral communities from ballast water - Michigan State University - AB_ballast water
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMichigan State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)736
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic → Aquatic Viral Communities From Harbor And Ballast Water - Michigan State University

Source Dataset Sampling Location
Location Name
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001484Metagenome / Metatranscriptome686Y

Sequences

Protein IDFamilyRBSSequence
Ga0119960_10391861F001484N/AVSQSRSEAISSVTTAGGVDTYVLTTDFGARLVRPDQVVQVYDTTMATFKGKGVITRWDTENKTIEVTPAVPGAAATDVLITDGLSNPTALPALYGVPYHHSNASTGTWLGYDRASTPEIRSNRVNGGNSALALASPRLAINKIGNRVGIDNNFDPTAWTHPCQAQAYEQIGQLISIIHKAPKDEALNLYFGDNMQLAGAPMKTHFNWNKTRIDFVVSSVWGRAEILPIGFYTSDGRRIFEIVTGK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.