


| Basic Information | |
|---|---|
| Taxon OID | 3300014776 Open in IMG/M |
| Scaffold ID | Ga0134555_1014041 Open in IMG/M |
| Source Dataset Name | Human fecal microbial community of Hadza hunter-gatherer populations from Tanzania - 10002 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Bologna |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1296 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Community Of Hadza Hunter-Gatherer And Regular Subjects From Tanzania And Italy |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Tanzania | |||||||
| Coordinates | Lat. (o) | -3.6347588 | Long. (o) | 35.0828588 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F088920 | Metagenome | 109 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0134555_10140411 | F088920 | N/A | VSANLHHYPAFWAGLILHLILHLILHFSQKVAIFALKRVILLLFVPTLFFAGLSVLFPQTSPKISGQTSLYQPWLSPYCLFKD* |
| ⦗Top⦘ |