


| Basic Information | |
|---|---|
| Taxon OID | 3300014717 Open in IMG/M |
| Scaffold ID | Ga0134334_12218 Open in IMG/M |
| Source Dataset Name | Human bile duct microbial communities from gallstone patients in Hangzhou, China - C4_bile |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Beijing Institution of Radiation Medicine |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 621 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Excretory System → Liver → Bile → Human Bile Duct → Human Bile Duct Microbial Communities From Gallstone Patients In Hangzhou, China |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | China: Hangzhou | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F077438 | Metagenome / Metatranscriptome | 117 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0134334_122181 | F077438 | N/A | THRDELSFRQSRFETLFSWNLQVEISLALRTMVEKEISSYKN* |
| ⦗Top⦘ |