


| Basic Information | |
|---|---|
| Taxon OID | 3300014716 Open in IMG/M |
| Scaffold ID | Ga0135282_11001 Open in IMG/M |
| Source Dataset Name | Maize phyllosphere microbial communities from California to study drought stress - PHYLLO11_watered_CA_Berkeley |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | J. Craig Venter Institute |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 536 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Maize Phyllosphere → Maize Phyllosphere Microbial Communities From Texas And California To Study Drought Stress |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Berkeley, California | |||||||
| Coordinates | Lat. (o) | 37.53128 | Long. (o) | -122.7598 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F073390 | Metagenome / Metatranscriptome | 120 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0135282_110011 | F073390 | N/A | KILAQSETALPFEDAKDPSAEASIIGGKFFTDIWDNGGREMAREIIQRSEKGIHDAREVAKAAKKSTESEGQLGTK* |
| ⦗Top⦘ |