NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0182021_10932174

Scaffold Ga0182021_10932174


Overview

Basic Information
Taxon OID3300014502 Open in IMG/M
Scaffold IDGa0182021_10932174 Open in IMG/M
Source Dataset NamePermafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1044
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen → Permafrost Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Stordalen
CoordinatesLat. (o)68.35Long. (o)19.05Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002448Metagenome / Metatranscriptome558Y

Sequences

Protein IDFamilyRBSSequence
Ga0182021_109321741F002448GGAMIHPKTLLAEWVTALQSLPNLVEALGGDGGQIQFYTENATVFGQPTQNNIRLAILSMPPGSVMVAWQGSGPGRLGNALVFVHDFSLYLRAPEDADVGYEDLFNWIVNDIPAGSSLRMLHTQIDINCEPMDFYLPSARRNTVVISADGATFEYFE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.