


| Basic Information | |
|---|---|
| Taxon OID | 3300014203 Open in IMG/M |
| Scaffold ID | Ga0172378_10360938 Open in IMG/M |
| Source Dataset Name | Groundwater microbial communities from an aquifer near a municipal landfill in Southern Ontario, Canada - Pumphouse #3_1 metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1105 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Leachate And Groundwater Microbial Communities From A Municipal Landfill And Adjacent Aquifer In Southern Ontario, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: Ontario | |||||||
| Coordinates | Lat. (o) | 43.442 | Long. (o) | -80.577 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F072892 | Metagenome | 121 | N |
| F076577 | Metagenome | 118 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0172378_103609382 | F072892 | GGAGG | MNINLLKTISTRLFGLYSQFKSIVSDLETNNTLDNREWAGELLNNLATELYYEANCLTDVLYPPRKEEKDETMFKIDGIINAERNPMSEDEFFELFIKWAEENKLQFGGGIGAYREEEEGEPLAGE* |
| Ga0172378_103609383 | F076577 | N/A | MELAFHFGAINYELNNGKKRREQWKNFKENAIDKGLKHINPDPRCTHPVNLDVLDHCWGYAEKIDKGEEIDMNELCEGCEFFREEVKNENPTQSN* |
| ⦗Top⦘ |