NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181531_10001760

Scaffold Ga0181531_10001760


Overview

Basic Information
Taxon OID3300014169 Open in IMG/M
Scaffold IDGa0181531_10001760 Open in IMG/M
Source Dataset NamePeatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)13566
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (41.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)47.1149Long. (o)-88.5476Alt. (m)Depth (m).1 to .2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000439Metagenome / Metatranscriptome1137Y

Sequences

Protein IDFamilyRBSSequence
Ga0181531_100017608F000439AGGTGGMDLSRTNGNGAQAVETQVNSISAQQVVKAAHDELLQLMRQRAEIMKRIGTVKQTIAGLANLFGDAVLGDDLLELIDRKPNGRQPGFTKACRRVLMDVRRPLGAREVCLELERYAPAILARHKDPLASVTTVLNRLVDYGEARSLSNDRGRRVWEWISEGEAAEAMTARRSA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.