


| Basic Information | |
|---|---|
| Taxon OID | 3300014144 Open in IMG/M |
| Scaffold ID | Ga0180443_102798 Open in IMG/M |
| Source Dataset Name | Chrysochromulina tobin associated microbial communities from unialgal haptophyte culture, Seattle, Washington, USA - P5_32mM MetaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 8394 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified → Defined Medium → Chrysochromulina Tobin Associated Microbial Communities From Unialgal Haptophyte Culture In Seattle, Washington, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Seattle, Washington | |||||||
| Coordinates | Lat. (o) | 47.6519 | Long. (o) | -122.3113 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F076927 | Metagenome / Metatranscriptome | 117 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0180443_1027981 | F076927 | N/A | GLNRGLQLAVPSHRRELQTAVSTSAGLTSALANTAVSRIVLASGTYNLIAELSITRSVILEAAAGATVTLNAQASFSSPRRVLNINPGSSGVVQLIGLGITGGYINWVRAHFQKFPSPRWETHVCDLLVVCRAAVSMSGEAQ* |
| ⦗Top⦘ |