


| Basic Information | |
|---|---|
| Taxon OID | 3300014083 Open in IMG/M |
| Scaffold ID | Ga0120366_100387 Open in IMG/M |
| Source Dataset Name | Fecal viral communites from wild urban brown rats in Berlin, Germany - Mu/10/1773 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Freie University Berlin |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1246 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Fecal → Fecal Viral Communites From Wild Urban Brown Rats In Berlin, Germany |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Germany: Berlin | |||||||
| Coordinates | Lat. (o) | 52.529611 | Long. (o) | 13.401343 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F082826 | Metagenome / Metatranscriptome | 113 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0120366_1003871 | F082826 | N/A | MSRYTIELNYNASISFEVEADNEGDALDKARDQAEEADIREFAIGHENESRVLRER* |
| ⦗Top⦘ |