NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0119889_1000727

Scaffold Ga0119889_1000727


Overview

Basic Information
Taxon OID3300013791 Open in IMG/M
Scaffold IDGa0119889_1000727 Open in IMG/M
Source Dataset NameWastewater microbial communities from municipal sewage treatment plant in Nanjing, China - DC_EW_meta
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterNanjing University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4367
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (42.86%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From Municipal Sewage Treatment Plants In Nanjing, China

Source Dataset Sampling Location
Location NameChina: Nanjing
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001488Metagenome / Metatranscriptome686Y

Sequences

Protein IDFamilyRBSSequence
Ga0119889_10007271F001488N/AMARLELTLNFPKHFHIKTFNVKSEPMLSPLAKSILQSVQFKHFYYVRDDIDYRLRSHPMERDFLLQALFSIVISLQNNLSINFFDMWIYEIYISKVSNANKFLKESSQNKEFDEYITIKLAYGI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.