


| Basic Information | |
|---|---|
| Taxon OID | 3300013286 Open in IMG/M |
| Scaffold ID | Ga0136641_1116097 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 738 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From High-Altitude Lakes In Yosemite National Park, California, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Elizabeth Lake, Yosemite National Park, California, USA | |||||||
| Coordinates | Lat. (o) | 37.8453 | Long. (o) | -119.3697 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F033702 | Metagenome / Metatranscriptome | 176 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0136641_11160971 | F033702 | N/A | MKYCKVCSKEIPERRVQLGYRDTCVEHSNAFRYVGLVAASGKCDYEISIIRDKETAEHMHRLAESRGAF* |
| ⦗Top⦘ |