


| Basic Information | |
|---|---|
| Taxon OID | 3300013137 Open in IMG/M |
| Scaffold ID | Ga0172375_10158512 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Restricted |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1826 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium TMED75 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Democratic Republic of the Congo: South-Kivu | |||||||
| Coordinates | Lat. (o) | -1.64 | Long. (o) | 29.05 | Alt. (m) | Depth (m) | 11 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005388 | Metagenome / Metatranscriptome | 402 | N |
| F009134 | Metagenome | 322 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0172375_101585121 | F009134 | N/A | QMHSVSLEKKVQSLETLSTLVRSKLASDAATTLERIDRYALDDIRDESVRETILGSVAKRSALVFGWAESGEQAQVSVNILGALPDRVSAEVQVNEPESKGI* |
| Ga0172375_101585122 | F005388 | N/A | MACPNVFNAFAVATESLAQDVYKRASYRSMWLNLIERGEYPQGTGLTQTSFTTTSIEPTAAEEWSAITLASGENGGACDVTYSDVPVGYNAVTWGPERFALKGPLLCKDDLTFDHRVEAFLRVYLEKLSIRAQRSWETRYQNMFAKYAIKAVADSSFTQVETIPSGVNELPWIQTGSVGQALNQATSELTQEMLDVAAATLIRNGATNPDSSGFISYSSDGPVFPLYIGLEASQRIAQNNAALREDLRFADMGSGPGAELLKRIGANRVIKNFRHIPNLFPPRFSYAGGKYTLIQPFTSSSGTKGTVFSVDPSWVSAQYEAAFVPTPYVIKSHIVRPVNRVGDLSWLPTNYMGEWQWVTGAYKLDVDCADPLEKKGQHYAEFVHAVEP |
| ⦗Top⦘ |