


| Basic Information | |
|---|---|
| Taxon OID | 3300013006 Open in IMG/M |
| Scaffold ID | Ga0164294_10015789 Open in IMG/M |
| Source Dataset Name | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 6206 |
| Total Scaffold Genes | 18 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (22.22%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wisconsin | |||||||
| Coordinates | Lat. (o) | 46.008 | Long. (o) | -89.701 | Alt. (m) | Depth (m) | 4 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F039633 | Metagenome | 163 | N |
| F085687 | Metagenome | 111 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0164294_1001578914 | F085687 | GGA | MNTITDRLLELLIGLGYFALAIAVCYGLMKFLGHKILSITATIFLIGFPAIGILGGTIEWIITGVAEASKSVTFNMADKCFGIAIGLYILAFFAYIFFSEEEKQRRKLDKWDRERATEPLQGME* |
| Ga0164294_1001578918 | F039633 | N/A | SMNEYPGYKNRATFVASVCLGESIQKLREDDPDMTVLDVKTECMEFLLNHSNHKFVNQFLHVIADDIDWDFLYNDDLKSQLAKV* |
| ⦗Top⦘ |