


| Basic Information | |
|---|---|
| Taxon OID | 3300012998 Open in IMG/M |
| Scaffold ID | Ga0157362_1049288 Open in IMG/M |
| Source Dataset Name | Fungus gardens microbial communities from leaf cutter ant in Ribeir?o Preto, State of S?o Paulo, Brazil - Atta laevigata ALBM3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2421 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Fungus Garden → Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Brazil: Ribeirao Preto, State of Sao Paulo | |||||||
| Coordinates | Lat. (o) | -21.166 | Long. (o) | -47.848 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F015172 | Metagenome | 256 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0157362_10492883 | F015172 | AGG | MGQGRRGEERLIERPWLQLMCCALVSSREVGRIFQSEGSRQDRGPKELSEGVGVDKRRLGPDDVNLQTEELHSNYSVLIVSVE* |
| ⦗Top⦘ |