


| Basic Information | |
|---|---|
| Taxon OID | 3300012953 Open in IMG/M |
| Scaffold ID | Ga0163179_10918468 Open in IMG/M |
| Source Dataset Name | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 758 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | North Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | 34.876 | Long. (o) | -13.1352 | Alt. (m) | Depth (m) | 80 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021179 | Metagenome / Metatranscriptome | 220 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0163179_109184683 | F021179 | N/A | MIELTEEEFKGDLAKYTTRIEHGEDFLIKKSSGEKYIATDVTKFQNPCDI* |
| ⦗Top⦘ |