


| Basic Information | |
|---|---|
| Taxon OID | 3300012939 Open in IMG/M |
| Scaffold ID | Ga0162650_100083450 Open in IMG/M |
| Source Dataset Name | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Shell Corporation |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 554 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Ranch near Red Deer, Alberta, Canada | |||||||
| Coordinates | Lat. (o) | 52.172047 | Long. (o) | -113.738964 | Alt. (m) | Depth (m) | .15 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F103211 | Metagenome / Metatranscriptome | 101 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0162650_1000834501 | F103211 | N/A | AGNVSLYVQNSEPGARDQAPSDISWSPDSTFVVDSTEGAE* |
| ⦗Top⦘ |