


| Basic Information | |
|---|---|
| Taxon OID | 3300012920 Open in IMG/M |
| Scaffold ID | Ga0160423_10051181 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3000 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater → Marine Microbial Communities From The Costa Rica Dome And Surrounding Waters |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Costa Rica: the Eastern Pacific | |||||||
| Coordinates | Lat. (o) | 8.7051 | Long. (o) | -86.4906 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F101208 | Metagenome / Metatranscriptome | 102 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0160423_100511811 | F101208 | GAGG | MGKVQIALSCKTVSTCVLLTLLLSGCYLNTAPDESMKMKHYTTILNAETQQILESMVKSLSEVNFEYEHITTQ* |
| ⦗Top⦘ |