


| Basic Information | |
|---|---|
| Taxon OID | 3300012919 Open in IMG/M |
| Scaffold ID | Ga0160422_10270318 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1041 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater → Marine Microbial Communities From The Costa Rica Dome And Surrounding Waters |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | The Central Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 10.0 | Long. (o) | -145.0 | Alt. (m) | Depth (m) | 60 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F085537 | Metagenome | 111 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0160422_102703181 | F085537 | GGAG | MSQINEQASRDTAPAGSIRFNTDSAKMEIYNGEQWWNIDATSPEQQTGGTRGLFAGGNTPSSTVDTI |
| ⦗Top⦘ |