


| Basic Information | |
|---|---|
| Taxon OID | 3300012890 Open in IMG/M |
| Scaffold ID | Ga0160428_1042525 Open in IMG/M |
| Source Dataset Name | Solar panel surface microbial communities from Lawrence Berkeley National Laboratory, California, USA - M |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1766 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Built Environment → Solar Panel → Unclassified → Unclassified → Solar Cell Surface → Solar Panel Surface Microbial Communities From Lawrence Berkeley National Laboratory, California, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Building 30, Lawrence Berkeley National Lab, Berkeley, California | |||||||
| Coordinates | Lat. (o) | 37.876387 | Long. (o) | -122.246777 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F104247 | Metagenome | 100 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0160428_10425253 | F104247 | GAG | MPSTPTPLRLFPTEAAAKKAGLALADFRGERLSMVLYALLPEGEKKPTYLLSNSIRLTVAEKRWVEEHQATVTKLGTFHPGRNFAPLQTNMVRRKKPTGED* |
| ⦗Top⦘ |