


| Basic Information | |
|---|---|
| Taxon OID | 3300012667 Open in IMG/M |
| Scaffold ID | Ga0157208_10001132 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Molecular Research LP (MR DNA) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 6338 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (87.50%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Freshwater Microbial Communities From Rivers And Streams Along An Organic Matter Gradient Associated With Agriculture In Ontario, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Keswick, Ontario | |||||||
| Coordinates | Lat. (o) | 44.22385 | Long. (o) | -79.4212 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F008245 | Metagenome / Metatranscriptome | 336 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0157208_100011328 | F008245 | AGGA | MAEDKNTLELISDITEFNDLHEFMKDEHLDKALAIVVKLLMNPDIPTAKAPMLIMELQAMSTKFAVMSSVYSTIAKDKAGTVNNNKKNVYYSVKESIDKLVDALKYVVRYNS* |
| ⦗Top⦘ |