


| Basic Information | |
|---|---|
| Taxon OID | 3300012666 Open in IMG/M |
| Scaffold ID | Ga0157498_1008125 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Molecular Research LP (MR DNA) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1696 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice → Freshwater Microbial Communities From Central Basin Lake Erie, Ontario, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Ontario, Canada | |||||||
| Coordinates | Lat. (o) | 42.6244481 | Long. (o) | -80.9227115 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F072344 | Metagenome | 121 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0157498_10081254 | F072344 | N/A | MIENKKTQIKYNYDFEESFDFRAHSFFNLLCDLEEEHVKRYFNVLQLYPRSDIIVGVKKKLYLLIGFLSGDLSDVLPVSFSSDEVSVIKLSLELYSNLLCGKFEILSKVFEGLSVDLNFESIISSLCENRDLFTNLVDKNSPLNISSNLIYYKGKWAWDMLGVLRGSEFEKIGSIPLIKIEEVDDSRRIRY* |
| ⦗Top⦘ |