


| Basic Information | |
|---|---|
| Taxon OID | 3300012530 Open in IMG/M |
| Scaffold ID | Ga0136635_10204295 Open in IMG/M |
| Source Dataset Name | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 675 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand → Polar Desert Microbial Communities From Antarctic Dry Valleys |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Antarctica: Dry Valley | |||||||
| Coordinates | Lat. (o) | -78.0243 | Long. (o) | 163.9173 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F012597 | Metagenome / Metatranscriptome | 279 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0136635_102042951 | F012597 | N/A | MFHEVAFDFLLDDGTDEPLLVEVAGGMLLDSFPDDRRVQFRSTTLLEIDHPFLTGLRLRDKEVNAAEVNIGAGDVVEVVGRLSHRLDPTAPAQSGRTPPERRALRSGLRVPVMVRRVSPSDAGLARVRRLLPKGPPDDSLGEPPIRKF* |
| ⦗Top⦘ |