


| Basic Information | |
|---|---|
| Taxon OID | 3300012491 Open in IMG/M |
| Scaffold ID | Ga0157329_1007338 Open in IMG/M |
| Source Dataset Name | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 800 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium RBG_16_71_46 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: North Carolina | |||||||
| Coordinates | Lat. (o) | 35.9076 | Long. (o) | -79.0506 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F091794 | Metagenome / Metatranscriptome | 107 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0157329_10073381 | F091794 | GAGG | MKIKIAVMMCAALGLPGVIFGQHHAPPATPTAEQSITGDWVIHFQAGHESVSGSLHLQADGERLAGTVETAHTGLGTVENGKWSKQKLEATLVFKKHESVVLEGELKSNGTLAGNYTTEGRTETWQAERKSATALNSNSGVYAQYEALIGTWDVTAPDGGPSFAVQRFTWGPGHSYIWYAGSFIGPGGKEDPHFEGMLVWNGVHKNLDMLLTMDLKSGLAEEQGTFNVATDGTIVREITG |
| ⦗Top⦘ |