NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0123365_1194922

Scaffold Ga0123365_1194922


Overview

Basic Information
Taxon OID3300012394 Open in IMG/M
Scaffold IDGa0123365_1194922 Open in IMG/M
Source Dataset NameMarine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_201_2m (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)609
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Microbial And Viral Regulation Of Community Carbon Cycling Across Diverse Low-Oxygen Zones

Source Dataset Sampling Location
Location NameLouisana Shelf, Hypoxic Zone, Gulf of Mexico
CoordinatesLat. (o)28.8679Long. (o)-90.4764Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014853Metatranscriptome259Y

Sequences

Protein IDFamilyRBSSequence
Ga0123365_11949221F014853N/AHGSGGNAAHCGSDPLVELAEEHGFAFICGEATQNVFGQGGQWDIPAEITDQTGTPCGNSDSVEPAYMQAIIDHLDKTPGKYDTKRLFTSGCSMGSAFSGYIANCLKHQDPTQISAFATHSTGLKYKGDGNRLPSNWGECDGCQWWPFAPVKYSDAAGLKACIFDNTGDGDFYQTSVYLAQKWPQLGNPTESHFASGGHCQNI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.