


| Basic Information | |
|---|---|
| Taxon OID | 3300012073 Open in IMG/M |
| Scaffold ID | Ga0153979_1007159 Open in IMG/M |
| Source Dataset Name | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA063 MetaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2610 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Georgia, Magnolia Springs State Park | |||||||
| Coordinates | Lat. (o) | 32.8826 | Long. (o) | -81.9512 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006376 | Metagenome | 374 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0153979_10071591 | F006376 | N/A | MIGGAFQSIDCVCFHINWEEVNPELLLKVSPGSDGENTSVYFFLKKHVFRLLGSMTTFEEHESPKNLLFFVVELFRGQADVQGAGV* |
| ⦗Top⦘ |