NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0153965_1021113

Scaffold Ga0153965_1021113


Overview

Basic Information
Taxon OID3300012069 Open in IMG/M
Scaffold IDGa0153965_1021113 Open in IMG/M
Source Dataset NameAttine ant fungus gardens microbial communities from Florida, USA - TSFL049 MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1494
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location
Location NameUSA: Florida, Paynes
CoordinatesLat. (o)27.6228Long. (o)-81.8094Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000488Metagenome1084Y

Sequences

Protein IDFamilyRBSSequence
Ga0153965_10211133F000488N/AMPTIRNTKKTFVECLSLKQKSVKDKSLLKRIGMDPTPSTKLYDKLVEANPCWHKVDDFYFSSCPPELHFCKNKKLLYIKEYKELLEPTLDCISPFFTKMSENKTWTEDPQYDSLWK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.