


| Basic Information | |
|---|---|
| Taxon OID | 3300012017 Open in IMG/M |
| Scaffold ID | Ga0153801_1009355 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Molecular Research LP (MR DNA) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1793 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Central Basin Lake Erie, Ontario, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Ontario, Canada | |||||||
| Coordinates | Lat. (o) | 42.6244481 | Long. (o) | -80.9227115 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021537 | Metagenome | 218 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0153801_10093551 | F021537 | N/A | MQTPEQKLKQLNKTIETLWHGVSDTKDGDYPRIVSLYKEVLKINYKDRDAWENMIWLMWSLAVNNKDTAWLFEAEKYVKRYLSLLPNGYRSHEY |
| ⦗Top⦘ |