


| Basic Information | |
|---|---|
| Taxon OID | 3300011340 Open in IMG/M |
| Scaffold ID | Ga0151652_11453308 Open in IMG/M |
| Source Dataset Name | Combined Assembly of Wetland Metatranscriptomes |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 864 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland → Microbial Community Impact On Carbon Sequestration In Managed Wetland Carbon Farming |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Twitchell Island, Sacramento and San Joaquin Delta, California, USA | |||||||
| Coordinates | Lat. (o) | 38.107 | Long. (o) | -121.6475 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F041496 | Metagenome / Metatranscriptome | 160 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0151652_114533082 | F041496 | GGAG | MNWSGLHLPTACAFRFSQPLDAFIRPEPAGLISCRIRSWGHPPELSSSRAAVHCSQRLSPLDVLTVYRVLLHARVRHSVQRFRLKTERVALLGLFPSRVLLLSALSRPSPVLPSCGCLLGRARPNGLHFRVFHAESAACLSRGRRPSWGFWPLVVMPTRASLGFWSRLRKRPGFVTAPWSAFL* |
| ⦗Top⦘ |