


| Basic Information | |
|---|---|
| Taxon OID | 3300011334 Open in IMG/M |
| Scaffold ID | Ga0153697_1190 Open in IMG/M |
| Source Dataset Name | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Daesung |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Chunlab, Inc |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 21193 |
| Total Scaffold Genes | 15 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 10 (66.67%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Lotic Viral Community From Han River, Hwacheon, Gangwon-Do, South Korea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Daesunglee, Gyeonggi-do, South Korea | |||||||
| Coordinates | Lat. (o) | 37.6746111 | Long. (o) | 127.3841278 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000843 | Metagenome / Metatranscriptome | 864 | Y |
| F015972 | Metagenome / Metatranscriptome | 250 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0153697_119011 | F000843 | N/A | MPLYQISPRELPEVWPVAAPLIQKAIDLDPTATTIQHVEYSIRTGKMFLLVWEEPGEGVTGACTVEFWDLPMERMAHVSLMGGKGIVRHHVFEEAKNWMRLHGATRAQCFAQGTLPQMYEKMGMENTHQVMRITL* |
| Ga0153697_11909 | F015972 | GGAG | MASKLVKAPRLPTAPVTYDREVFDNIFSIIRQYFNQLDNPGPINIATQRNPAVGSAPAYIFSALSCVQPSPSNPAQFVISLPTQADFANLRSGDVYYDTSGGVATSYPLRIKA* |
| ⦗Top⦘ |