NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0136587_1170612

Scaffold Ga0136587_1170612


Overview

Basic Information
Taxon OID3300011188 Open in IMG/M
Scaffold IDGa0136587_1170612 Open in IMG/M
Source Dataset NameSaline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 1 #563
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)564
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameAntarctica: Rauer Islands
CoordinatesLat. (o)-68.5558Long. (o)78.1913Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F039957Metagenome / Metatranscriptome162Y

Sequences

Protein IDFamilyRBSSequence
Ga0136587_11706121F039957N/AFNMTNPATSQPSPSVLVRASVMSVFGDVSPVVTTTMVKKTEELLGVHNGSSPLEVLVPTFEIKTVEQNTPLAAIINTITVSIKANCDLPPGSTVTIHELTGSASASDSMLRIVHGNGGLADTGEWDASGNLTMTSVGMLRPQTYEARFNMTNPATSQPSPSVLVRASVMSVFGDVSPVVTTTMVKKT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.