


| Basic Information | |
|---|---|
| Taxon OID | 3300011006 Open in IMG/M |
| Scaffold ID | Ga0139320_1073578 Open in IMG/M |
| Source Dataset Name | Rumen fluid microbial communities from healthy moose, Palmer, Alaska - F08 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Ohio State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 925 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Foregut → Rumen → Moose Rumen → Rumen Microbial Communities From Healthy Moose, Palmer, Alaska |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Palmer, Alaska | |||||||
| Coordinates | Lat. (o) | 61.5997 | Long. (o) | -148.1128 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026765 | Metagenome / Metatranscriptome | 196 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0139320_10735781 | F026765 | N/A | NNYITSLKPGECTDFSHYNRDYYCDNFDRNYPLEEDKIFSNKSKDAQTWIAGDKYKIYPQHIPNVQCHVPGIYSSNIYGLGYSKSTAVSIKGDYSKEQNCTNEERFKSTNQKIYTKPKTKSIEEEKTLAKTAQKFFNPHDPNNQRNYSLDRINRIYHSKIAKVPTVGYAGTQSIFQKQIGYLNYDKILEKERLSKLGPGKASYADLPPKFQDALKIVKYDEDLPYIVGYRGFRVGVKARNFHGENFHNVSLKARNEAKVIPVQ* |
| ⦗Top⦘ |