NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0139311_1082594

Scaffold Ga0139311_1082594


Overview

Basic Information
Taxon OID3300010998 Open in IMG/M
Scaffold IDGa0139311_1082594 Open in IMG/M
Source Dataset NameRumen fluid microbial communities from healthy moose, Palmer, Alaska - F02
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterOhio State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1647
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Moose Rumen → Rumen Microbial Communities From Healthy Moose, Palmer, Alaska

Source Dataset Sampling Location
Location NamePalmer, Alaska
CoordinatesLat. (o)61.5997Long. (o)-148.112Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F072950Metagenome / Metatranscriptome120N

Sequences

Protein IDFamilyRBSSequence
Ga0139311_10825942F072950N/AMKDIICNIPYVLITLYRGNRLFIFVAINFWYSDYLQNSLLEKNPKVIFWSYSITMVIASLIGNVLGGVVINKIGGTKSRHSYVAMGVLQFLCVLFGLFAPFTDSVLIFTILMSMYILINSASGIITISASFAVMPKTLTGTATGIYSLVVNLIAFLPAPYAYAFIKSIVGEGSYIMVVLMLYGLFGCFEIMAADIYMRVKKIKIYKDDFKSMVVKEEK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.