


| Basic Information | |
|---|---|
| Taxon OID | 3300010996 Open in IMG/M |
| Scaffold ID | Ga0139308_122281 Open in IMG/M |
| Source Dataset Name | ELM11109_Aassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method A (2X250bp) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Molecular Research LP (MR DNA) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 914 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment → Cwc Coastal Marshes |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Louisiana, Port Sulphur, Bay Sansbois east | |||||||
| Coordinates | Lat. (o) | 29.4542 | Long. (o) | -89.76993 | Alt. (m) | Depth (m) | 0 to .02 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F008812 | Metagenome / Metatranscriptome | 327 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0139308_1222813 | F008812 | AGG | MAAKRGIRSMLQWIGPIVAIIGLLWTGVKDYQKGDIKLPKLPQKQVLTKPVYPIQYCLMAYDPNNDKVWYQHEDGRWYEYAPPQRRYAATPQYNQNQNQATVGTAYGTSTGSVGHYVR* |
| ⦗Top⦘ |