


| Basic Information | |
|---|---|
| Taxon OID | 3300010965 Open in IMG/M |
| Scaffold ID | Ga0138308_124645 Open in IMG/M |
| Source Dataset Name | Microbial communities from Lake Cadagno chemocline, Switzerland. Combined Assembly of Gp0156211, Gp0156621 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Max Planck Institute for Marine Microbiology, Max Planck Institute for Plant Breeding Research |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2900 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Chemocline → Microbial Communities From Lake Cadagno Chemocline, Switzerland. |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Cadagno, Switzerland | |||||||
| Coordinates | Lat. (o) | 46.5499 | Long. (o) | 8.711 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001279 | Metagenome | 732 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0138308_1246452 | F001279 | AGGA | MAVSTTIKVVGVKDTINALKKIDPQLQKDFRTKANQIAEPAIKAAKEMYAEIPLSGMKYNWTSPGRDRKNFPFSVAKAKSGVKLRIDTRRNAIGVILIEQKDPAAAIFETAGRANANRLGDQLGFVGPGRTRFIGPAVYRARRGIEDEMKKMILDTASVVRKSL* |
| ⦗Top⦘ |