


| Basic Information | |
|---|---|
| Taxon OID | 3300010857 Open in IMG/M |
| Scaffold ID | Ga0126354_1218635 Open in IMG/M |
| Source Dataset Name | Boreal forest soil eukaryotic communities from Alaska, USA - W1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 532 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil → Forest Soil Eukaryotic Communities From Alaska, Usa, For A Soil Warming Experiment In A Boreal Forest |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Alaska, USA | |||||||
| Coordinates | Lat. (o) | 63.883 | Long. (o) | -145.733 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F064734 | Metagenome / Metatranscriptome | 128 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0126354_12186351 | F064734 | N/A | FPACSPPACTVLSTALKSAGRFASLLPYGWFGQPQDQCFKARRSFSLKWDRSLVTAFPSPATAAPFRAPIPGSMVLACYFALSRQISLPVRPFCSATGTGSPRSRPLLRFWPVTARLAASTCRYSGLRSPLGPLPPFGSKRSAGLAAGRSAFRIRPIPSRSPLPVLFQLRLRIIVP |
| ⦗Top⦘ |