


| Basic Information | |
|---|---|
| Taxon OID | 3300010394 Open in IMG/M |
| Scaffold ID | Ga0126341_1230219 Open in IMG/M |
| Source Dataset Name | Coral microbial communities from Florida Keys, Florida, USA - Orbicella T D metagenome |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 512 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral → Coral Microbial Communities From Various Locations To Study Host-Microbial Communication |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Florida Keys, Florida, USA | |||||||
| Coordinates | Lat. (o) | 24.6669 | Long. (o) | -81.5441 | Alt. (m) | Depth (m) | 2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F014704 | Metagenome / Metatranscriptome | 260 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0126341_12302191 | F014704 | N/A | MITTVNEVNNDKTKVPDEFVFRSISLICFAAELDDQCTCKLII |
| ⦗Top⦘ |