


| Basic Information | |
|---|---|
| Taxon OID | 3300010391 Open in IMG/M |
| Scaffold ID | Ga0136847_10025729 Open in IMG/M |
| Source Dataset Name | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Minnesota - Twin Cities |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 616 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment → Lake Superior Sediments |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Superior, USA | |||||||
| Coordinates | Lat. (o) | 47.1675 | Long. (o) | -89.65985 | Alt. (m) | Depth (m) | 190 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F016934 | Metagenome / Metatranscriptome | 243 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0136847_100257292 | F016934 | AGGA | MARVRSLEGREAGILARLIQAIFRVVLGRPLNPIKVQAHATRAMLSSFLSNVILGSGRWKVGTELVHLVRIRAAARNGCPF* |
| ⦗Top⦘ |