


| Basic Information | |
|---|---|
| Taxon OID | 3300010388 Open in IMG/M |
| Scaffold ID | Ga0136551_1011150 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1857 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water → Freshwater Microbial Communities From The Surface Of The Forest Pond In Jussy, Geneva, Switzerland |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Jussy, Geneva, SWITZERLAND | |||||||
| Coordinates | Lat. (o) | 46.25 | Long. (o) | 6.28 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F004276 | Metagenome / Metatranscriptome | 445 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0136551_10111504 | F004276 | AGGAG | MLLREMFSPIGAPNEGEVDVDWLDDLKFFIDNDDKMLNQYFFPAVKRHRDYVGNPNAYKIYIKPIENCLGHYCKQFNVEEPEEKFPKEKLIDLAKRFANEQEQHIEKGDYEA* |
| ⦗Top⦘ |