


| Basic Information | |
|---|---|
| Taxon OID | 3300010332 Open in IMG/M |
| Scaffold ID | Ga0116200_10099831 Open in IMG/M |
| Source Dataset Name | Marine hydrothermal vent microbial communities from Guaymas Basin, Gulf of California to study Microbial Dark Matter (Phase II) - Marker 14 Mat core 4571-4 3-6 cm metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1498 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mexico: Guaymas Basin, Gulf of California | |||||||
| Coordinates | Lat. (o) | 27.0078 | Long. (o) | -111.4071 | Alt. (m) | Depth (m) | 2000 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F029623 | Metagenome | 187 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0116200_100998313 | F029623 | GAG | MNAYTKYVRARLEQGNLIIEVSKDAFKDDEAKKETVKELKQLIKTYFGLRFFIRLSIVYALTALFCACVALAIVLVK* |
| ⦗Top⦘ |