


| Basic Information | |
|---|---|
| Taxon OID | 3300010281 Open in IMG/M |
| Scaffold ID | Ga0134090_1071310 Open in IMG/M |
| Source Dataset Name | Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 1_4_20_6_A1 metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 669 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading → Switchgrass Degrading Microbial Communities From High Solid Loading Bioreactors In New Hampshire, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Dartmouth College, New Hampshire | |||||||
| Coordinates | Lat. (o) | 43.726 | Long. (o) | -72.1429 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F010244 | Metagenome / Metatranscriptome | 306 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0134090_10713102 | F010244 | GGAGG | MTHKVKFTHSDKSRAHIDRTKVREGKEVYRHPRGYFVVLEFEGVSGKFRETFWPEEILKQELFL* |
| ⦗Top⦘ |