


| Basic Information | |
|---|---|
| Taxon OID | 3300010236 Open in IMG/M |
| Scaffold ID | Ga0136246_10068280 Open in IMG/M |
| Source Dataset Name | Terrestrial oil reservoir microbial community from Schrader Bluff Formation, Alaska - SB1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Yale Center for Genome Analysis |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 609 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Produced Fluid → Terrestrial Oil Reservoir Microbial Communities From Alaska |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Alaska, USA | |||||||
| Coordinates | Lat. (o) | 70.4 | Long. (o) | -148.7 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F016798 | Metagenome / Metatranscriptome | 244 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0136246_100682801 | F016798 | AGGAG | MKKFILILLLLTLVSCEKEFKELQRSYVISNFIELNNDLDYKLVYFCDKYNAFEHFYDIKYTIFNEIGEHNYYKDMQTRMAVVSHTRDTGTCQFQHRTFYYLAEKYDIKGANILSESQQIAVMVQAFVDGKQGWWCGYKKYKNK* |
| ⦗Top⦘ |